Anti-Peroxiredoxin 4抗体(ab59542)

Thank you for contacting us.

The source of ab16943 informed us that theimmunogen used for this antibody isa recombinant human fragment protein (without secretion leader sequence) purified from E.coli. Only the region “WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAK” is common to your sequence. Furthermore, the epitope has not been mapped for this antibody, therefore we cannot determineifab16943 candetect the antigen you mentioned.

We have several anti-Peroxiredoxin 4 antibodies in our catalogue and one of themseems to be suitable for thedetectionof the sequence you sent. The reference of this antibody is ab59542, https://www.abcam.com/ab59542 (immunogen SRVSVADHSLHLSKAKISK).

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

I received some useful information from the laboratory that developed this antibody: "In human lung we see two very clean bands, one around 29kD and the other around 60kD. This protein is reported as being synthesised as a 31kD protein and a signal peptide cleaved prior to secretion resulting in a 27kd protein, a couple of papers have shown these two bands. This protein does form a dimer and under non reducing conditions the two proteins 29 and 60kd are clearly visible. This is shown very clearly in a recently published paper (http://www.biochemj.org/bj/imps/abs/BJ20071428.htm). We would suggest the customer have a read of this paper. We would send an image of a blot but one of our researchers wishes to use it in a publication shortly. We see the two bands 29 and 60kD even on reducing gel/blots which probably reflects incomplete reduction. The blots in the paper above are very similar to what we achieve." They also suggest something you have no doubt already done: Pubmed search for Peroxiredoxin IV (not 4) in the title. I hope the above information is useful. If you have any questions, please do not hesitate to contact us.